(data stored in ACNUC7421 zone)

EMBL: CP000948.YLBF

CP000948.YLBF        Location/Qualifiers
FT   CDS             488182..488997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECDH10B_0476"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01645"
FT                   /protein_id="ACB01645.1"
FT                   /translation="MTIIHPLLASSSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     MTIIHPLLAS SSAPNYRQSW RLAGVWRRAI NLMTESGELL TLHRQGSGFG PGGWVLRRAQ        60
     FDALCGGLCG NERPQVVAQG IRLGRFTVKQ PQRYCLLRIT PPAHPQPLAA AWMQRAEETG       120
     LFGPLALAAS DPLPAELRQF RHCFQAALNG VKTDWRHWLG KGPGLTPSHD DTLSGMLLAA       180
     WYYGALDARS GRPFFACSDN LQLVTTAVSV SYLRYAAQGY FASPLLHFVH ALSCPKRTAV       240
     AIDSLLALGH TSGADTLLGF WLGQQLLQGK P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page