(data stored in ACNUC7421 zone)

EMBL: CP000948.YLCG

CP000948.YLCG        Location/Qualifiers
FT   CDS             512285..512425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcG"
FT                   /locus_tag="ECDH10B_0507"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01674"
FT                   /protein_id="ACB01674.1"
FT                   /translation="MMFEFNMAELLRHRWGRLRLYRFPGSVLTDYRILKNYAKTLTGAG
FT                   V"
     MMFEFNMAEL LRHRWGRLRL YRFPGSVLTD YRILKNYAKT LTGAGV                       46
//

If you have problems or comments...

PBIL Back to PBIL home page