(data stored in ACNUC1104 zone)

EMBL: CP000959.PE1

CP000959.PE1         Location/Qualifiers
FT   CDS             complement(29..481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_4042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92342"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="UniProtKB/TrEMBL:B1K862"
FT                   /protein_id="ACA92342.1"
FT                   /translation="MRGVRIAAALACIAFQPAMVVAKDAARAAPEAGSRTYLQNFKDLV
FT                   LAECLATAYKQAPGVSKDIGSSASALRDWTYYDMERAPDVIHALVAKYLARDYRNPVVE
FT                   SEVADVKFDFLKCIDLYHGKELDAAAKQFVSRPNRTYRTEHPPTPH"
     MRGVRIAAAL ACIAFQPAMV VAKDAARAAP EAGSRTYLQN FKDLVLAECL ATAYKQAPGV        60
     SKDIGSSASA LRDWTYYDME RAPDVIHALV AKYLARDYRN PVVESEVADV KFDFLKCIDL       120
     YHGKELDAAA KQFVSRPNRT YRTEHPPTPH                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page