(data stored in ACNUC1104 zone)

EMBL: CP000959.PE10

CP000959.PE10        Location/Qualifiers
FT   CDS             11362..11664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92351"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B1K871"
FT                   /protein_id="ACA92351.1"
FT                   /translation="MKSLVVTAAAAVLLAAPALSFAQQAKSPVTRAQVLQELIDLESVG
FT                   YNPARGEIGNYPEDILSAQERLQTKRLAERKAAQAAYGPAGEPATESGAAAKPAL"
     MKSLVVTAAA AVLLAAPALS FAQQAKSPVT RAQVLQELID LESVGYNPAR GEIGNYPEDI        60
     LSAQERLQTK RLAERKAAQA AYGPAGEPAT ESGAAAKPAL                             100
//

If you have problems or comments...

PBIL Back to PBIL home page