(data stored in ACNUC1104 zone)

EMBL: CP000959.PE101

CP000959.PE101       Location/Qualifiers
FT   CDS             complement(114912..115601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3286"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bam:Bamb_3653 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG1
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG1 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92442"
FT                   /db_xref="GOA:B1K8U5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U5"
FT                   /protein_id="ACA92442.1"
FT                   /translation="MELSCTTAAAPPLPVAIGTVYGALLNERAALDALGDAVNAPPYGR
FT                   PPQAPILYIKSANTHAADGAAVIVPAGVDALEIGASVAVVFARRATRVPAARALDYVHG
FT                   FTLASDVSVPHPDYYRPAVRFKCRDGFCPLGPTIVPAAALADVDAIGLTVRIDGEVAAS
FT                   ASTATLIRPVRALIADVTAFMSFDAGDVLLLGVAGGAPRARAGSTIEIAAAGIGTLRHT
FT                   LTAEDAR"
     MELSCTTAAA PPLPVAIGTV YGALLNERAA LDALGDAVNA PPYGRPPQAP ILYIKSANTH        60
     AADGAAVIVP AGVDALEIGA SVAVVFARRA TRVPAARALD YVHGFTLASD VSVPHPDYYR       120
     PAVRFKCRDG FCPLGPTIVP AAALADVDAI GLTVRIDGEV AASASTATLI RPVRALIADV       180
     TAFMSFDAGD VLLLGVAGGA PRARAGSTIE IAAAGIGTLR HTLTAEDAR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page