(data stored in ACNUC1104 zone)

EMBL: CP000959.PE104

CP000959.PE104       Location/Qualifiers
FT   CDS             118138..118485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92445"
FT                   /db_xref="InterPro:IPR021947"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U8"
FT                   /protein_id="ACA92445.1"
FT                   /translation="MRLTIRINGSESATRHSFAVLWVDTDEGLWSREAHQGIDLPTWGK
FT                   IRDVEGAMALCAADSGNAVCQLKGLSFDAMRREQGPAVLAGEHPDGAWRLQAVDTCTTQ
FT                   PEYREFISVAR"
     MRLTIRINGS ESATRHSFAV LWVDTDEGLW SREAHQGIDL PTWGKIRDVE GAMALCAADS        60
     GNAVCQLKGL SFDAMRREQG PAVLAGEHPD GAWRLQAVDT CTTQPEYREF ISVAR            115
//

If you have problems or comments...

PBIL Back to PBIL home page