(data stored in ACNUC1104 zone)

EMBL: CP000959.PE105

CP000959.PE105       Location/Qualifiers
FT   CDS             118906..120804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3290"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   bur:Bcep18194_B1788 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92446"
FT                   /db_xref="GOA:B1K8U9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U9"
FT                   /protein_id="ACA92446.1"
FT                   /translation="MSVKKKTHPADPYAAATKNPMLASRLPMWRSRLIVVVVFLAFAAL
FT                   IARAFWVQVANQDFYVGQGQKRYQRTIELDAMRGRIVDRNGAMLAVSLSTYEIWANPKQ
FT                   VADTDYPQIAKLLDLPLVEVKRRLGNDKTFVLLKRQVDADTASRLDKLAIDGITQIADS
FT                   KRFYPEGESAAHVVGFTNVEDKGQEGVELAANARLQGTSGQREVIRDRLGRIVSDTRPL
FT                   VPAQHGATIELTIDRRIQQLAFSQLKAAVIENNAVAGSVVVLDAQNGEILALANYPTFD
FT                   PNDRARLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDERKVTPNTVINTSPGTYKIGPA
FT                   VIHDTSNHGSLTVSQALQKSSNVALAKLALNLPAETIWNKYQEYGIGRAPELTFPGVAS
FT                   GRLRGYKRWRPIEQATMAYGYGLSMSLLQIAQTYTAYAGDGTLHPVSLLKNGTDQQTID
FT                   AHRGHRVTSPQTAAAIRSMLEMAVGEGGTGRRARVDGYRIGGKTGTARKQVGASYAKGK
FT                   YRALFAGMAPMSNPRLIVAVMIDEPRGKGYYGGTVAGPVFASVTSGSLQLLGVPPDAPV
FT                   EPEKNAPAKAAAPQKTVAAPKAAAPATATVAQKPSAQLKTAAQSSRPAPAKMAAAG"
     MSVKKKTHPA DPYAAATKNP MLASRLPMWR SRLIVVVVFL AFAALIARAF WVQVANQDFY        60
     VGQGQKRYQR TIELDAMRGR IVDRNGAMLA VSLSTYEIWA NPKQVADTDY PQIAKLLDLP       120
     LVEVKRRLGN DKTFVLLKRQ VDADTASRLD KLAIDGITQI ADSKRFYPEG ESAAHVVGFT       180
     NVEDKGQEGV ELAANARLQG TSGQREVIRD RLGRIVSDTR PLVPAQHGAT IELTIDRRIQ       240
     QLAFSQLKAA VIENNAVAGS VVVLDAQNGE ILALANYPTF DPNDRARLTG QQLRNRAVID       300
     TFEPGSTIKP LVVALSIDER KVTPNTVINT SPGTYKIGPA VIHDTSNHGS LTVSQALQKS       360
     SNVALAKLAL NLPAETIWNK YQEYGIGRAP ELTFPGVASG RLRGYKRWRP IEQATMAYGY       420
     GLSMSLLQIA QTYTAYAGDG TLHPVSLLKN GTDQQTIDAH RGHRVTSPQT AAAIRSMLEM       480
     AVGEGGTGRR ARVDGYRIGG KTGTARKQVG ASYAKGKYRA LFAGMAPMSN PRLIVAVMID       540
     EPRGKGYYGG TVAGPVFASV TSGSLQLLGV PPDAPVEPEK NAPAKAAAPQ KTVAAPKAAA       600
     PATATVAQKP SAQLKTAAQS SRPAPAKMAA AG                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page