(data stored in ACNUC1104 zone)

EMBL: CP000959.PE106

CP000959.PE106       Location/Qualifiers
FT   CDS             complement(120832..122547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3291"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger; KEGG: bur:Bcep18194_B1791 TrkA-N family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92447"
FT                   /db_xref="GOA:B1K8V0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V0"
FT                   /protein_id="ACA92447.1"
FT                   /translation="MPHDVSLIALLAAGFGLAMIFGYLASLLKMPPLVGYLLAGIVIGP
FT                   GTPGFVGDLSLAQQLAEVGVMLLMFGVGLHFSLGDLLAVRKIALPGAIVQITVATLLGG
FT                   GLALTWGWSLGAALVFGLALSVASTVVLLRALEGRGLVETVNGRIAVGWLVVEDLVMVL
FT                   VLVLLPPVAGLLGGTPPGDTHAAGGSVWGTLGVTMLKVAAFIALMLVVGKRVFPRILWL
FT                   VARTGSRELFTLCMIAAAVGIAFGAAKLFDVSFALGAFFAGMMMRESEFSRRAADETLP
FT                   LRDAFSVLFFISVGMLFDPKVLLDEPLHVIEVAAIVLIGKTVAAVALVIAFRYPLNTAL
FT                   TVGAGLAQIGEFSFILAGLGRALGLLSAEGQSLILAVALISIAMNTLLFAMIDPALAWI
FT                   RKHSAFARKLEARDDPLAALPMSTPQTHLTGQVVIVGYGKVGTRIAHALDERGIAYVVV
FT                   EQNRELVEKLRADGIAAVSGDAIEPIVLVQAHIARAGMLVVTLPDVFDVRQIVEISRTL
FT                   NPALEVVLCTNSGDEAALLSSEGIGTVFMGETELARGMTEHVLGRMAKPVAAAH"
     MPHDVSLIAL LAAGFGLAMI FGYLASLLKM PPLVGYLLAG IVIGPGTPGF VGDLSLAQQL        60
     AEVGVMLLMF GVGLHFSLGD LLAVRKIALP GAIVQITVAT LLGGGLALTW GWSLGAALVF       120
     GLALSVASTV VLLRALEGRG LVETVNGRIA VGWLVVEDLV MVLVLVLLPP VAGLLGGTPP       180
     GDTHAAGGSV WGTLGVTMLK VAAFIALMLV VGKRVFPRIL WLVARTGSRE LFTLCMIAAA       240
     VGIAFGAAKL FDVSFALGAF FAGMMMRESE FSRRAADETL PLRDAFSVLF FISVGMLFDP       300
     KVLLDEPLHV IEVAAIVLIG KTVAAVALVI AFRYPLNTAL TVGAGLAQIG EFSFILAGLG       360
     RALGLLSAEG QSLILAVALI SIAMNTLLFA MIDPALAWIR KHSAFARKLE ARDDPLAALP       420
     MSTPQTHLTG QVVIVGYGKV GTRIAHALDE RGIAYVVVEQ NRELVEKLRA DGIAAVSGDA       480
     IEPIVLVQAH IARAGMLVVT LPDVFDVRQI VEISRTLNPA LEVVLCTNSG DEAALLSSEG       540
     IGTVFMGETE LARGMTEHVL GRMAKPVAAA H                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page