(data stored in ACNUC1104 zone)

EMBL: CP000959.PE109

CP000959.PE109       Location/Qualifiers
FT   CDS             complement(125957..126697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3294"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: bur:Bcep18194_B1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92450"
FT                   /db_xref="GOA:B1K8V3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V3"
FT                   /protein_id="ACA92450.1"
FT                   /translation="MSTPPDKPNSRRRFLRTSVALVPIASVAGCDLHSSSPSATTAGNA
FT                   SAASASAERAPYKPTFFDAKEWAFVQAAVDRLIPADAEGPGALEAGVPEFIDRQMETPY
FT                   AHGATWYMQGPFQQGVPELGYQLKLVPRDIYRLGIAAVNRYCEKTHGKAFADLDAPTRD
FT                   TVLGALEKGGAQIDDVPPGVFLGQLLQNTREGYFCDPVHGGNRDMAAWKMIGFPGARAD
FT                   FMDFVNQSGKPYPYGPVSINGERS"
     MSTPPDKPNS RRRFLRTSVA LVPIASVAGC DLHSSSPSAT TAGNASAASA SAERAPYKPT        60
     FFDAKEWAFV QAAVDRLIPA DAEGPGALEA GVPEFIDRQM ETPYAHGATW YMQGPFQQGV       120
     PELGYQLKLV PRDIYRLGIA AVNRYCEKTH GKAFADLDAP TRDTVLGALE KGGAQIDDVP       180
     PGVFLGQLLQ NTREGYFCDP VHGGNRDMAA WKMIGFPGAR ADFMDFVNQS GKPYPYGPVS       240
     INGERS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page