(data stored in ACNUC1104 zone)

EMBL: CP000959.PE110

CP000959.PE110       Location/Qualifiers
FT   CDS             complement(127438..127854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92451"
FT                   /db_xref="GOA:B1K8V4"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V4"
FT                   /protein_id="ACA92451.1"
FT                   /translation="MTGAYFSVPTLCAIALVHVYWAFGGRLGKRAAIPEQDGVPLLRPT
FT                   AVGTLTVALALLGGAGVVAARAGWLGRNAYPCTIAFAVVALALIFAVRAVGDFRYVGFF
FT                   KRIRGSRFARMDTLYYSPLCAALALSIASMFWPW"
     MTGAYFSVPT LCAIALVHVY WAFGGRLGKR AAIPEQDGVP LLRPTAVGTL TVALALLGGA        60
     GVVAARAGWL GRNAYPCTIA FAVVALALIF AVRAVGDFRY VGFFKRIRGS RFARMDTLYY       120
     SPLCAALALS IASMFWPW                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page