(data stored in ACNUC1104 zone)

EMBL: CP000959.PE115

CP000959.PE115       Location/Qualifiers
FT   CDS             complement(133427..134209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3301"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="SMART: regulatory protein Crp; KEGG:
FT                   bur:Bcep18194_B1802 putative transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92456"
FT                   /db_xref="GOA:B1K8V9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V9"
FT                   /protein_id="ACA92456.1"
FT                   /translation="MLHLHSSYSANAILAALPEDSIRTIAPHLELVRIKAGMLDRVGEP
FT                   MRHLHFPTTAMMSVQHLMEDGAMVEVAVVGREGVVGLGTLVGGIAASNRVEVRIGGMAY
FT                   RVPSCVMRAEFERSPQTYRLLLNTCQATMAQISRSALCNRHHSVSEQLSRWLLLAHDRI
FT                   DGDELAVTQQTIANMLGVRREGVTEAAGNLQEAGLIRQRRGRITVLDRDGLEHHACECY
FT                   DLIRADYRRLLGTRGNAMPATVRSRMPEGHRGFPAHGA"
     MLHLHSSYSA NAILAALPED SIRTIAPHLE LVRIKAGMLD RVGEPMRHLH FPTTAMMSVQ        60
     HLMEDGAMVE VAVVGREGVV GLGTLVGGIA ASNRVEVRIG GMAYRVPSCV MRAEFERSPQ       120
     TYRLLLNTCQ ATMAQISRSA LCNRHHSVSE QLSRWLLLAH DRIDGDELAV TQQTIANMLG       180
     VRREGVTEAA GNLQEAGLIR QRRGRITVLD RDGLEHHACE CYDLIRADYR RLLGTRGNAM       240
     PATVRSRMPE GHRGFPAHGA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page