(data stored in ACNUC1104 zone)

EMBL: CP000959.PE116

CP000959.PE116       Location/Qualifiers
FT   CDS             135131..135913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3302"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   bur:Bcep18194_B1803 cyclic nucleotide-binding domain
FT                   (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92457"
FT                   /db_xref="GOA:B1K8W0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8W0"
FT                   /protein_id="ACA92457.1"
FT                   /translation="MTHQAADAVAHANGMIELSHSFDANRFLAAIDRDELLTLTPHLQL
FT                   VHLKSGQVLCEPGEMLAAVYLPVTTAISLQYVSSGGMTLEVAEIGSESVVCDDVIGGSG
FT                   RMPCRALACRDGFVYRLDRRVFAAAFDASPVIRHLVFVCVRLLMAQVSQITFCSRHHVL
FT                   KHQLCRWFLLAFDRTRSIEIQVTHSMLAQMLGVRRETVTDAAGEIQKLGLIRQYRSSIE
FT                   LADLDGLEKMSCGCRAIVRDEMKRILSADSGVPAASRA"
     MTHQAADAVA HANGMIELSH SFDANRFLAA IDRDELLTLT PHLQLVHLKS GQVLCEPGEM        60
     LAAVYLPVTT AISLQYVSSG GMTLEVAEIG SESVVCDDVI GGSGRMPCRA LACRDGFVYR       120
     LDRRVFAAAF DASPVIRHLV FVCVRLLMAQ VSQITFCSRH HVLKHQLCRW FLLAFDRTRS       180
     IEIQVTHSML AQMLGVRRET VTDAAGEIQK LGLIRQYRSS IELADLDGLE KMSCGCRAIV       240
     RDEMKRILSA DSGVPAASRA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page