(data stored in ACNUC1104 zone)

EMBL: CP000959.PE117

CP000959.PE117       Location/Qualifiers
FT   CDS             136033..136344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3303"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   bur:Bcep18194_B1804 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92458"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8W1"
FT                   /protein_id="ACA92458.1"
FT                   /translation="MSALIARLPERTTPRTPEQHVKNEIRTILKHVAHLEAAIDSIGDG
FT                   DDLYEAGLSSLDTIQLMLAIEKQFNIEIPDEMLNRNLFRSIDALADTIATLQRTEHSA"
     MSALIARLPE RTTPRTPEQH VKNEIRTILK HVAHLEAAID SIGDGDDLYE AGLSSLDTIQ        60
     LMLAIEKQFN IEIPDEMLNR NLFRSIDALA DTIATLQRTE HSA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page