(data stored in ACNUC1104 zone)

EMBL: CP000959.PE12

CP000959.PE12        Location/Qualifiers
FT   CDS             12922..15105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3197"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: bur:Bcep18194_B1682 fusaric acid resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92353"
FT                   /db_xref="GOA:B1K873"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B1K873"
FT                   /protein_id="ACA92353.1"
FT                   /translation="MKPQPAIERPSIEPARWSAWLDPLGNAARDWAATDGLIWLHLAKT
FT                   VLAALLAMGIAMRLEMSQPRTAMTTVFVLMQPLSGMVFAKSFYRVLGTAAGLVGALALG
FT                   GLFAQQPELYMAGITLWIGGCIALAVRNRHFRWYGFVLAGYTAALIGLPAVMTPQTLFQ
FT                   SALTRAAEVALGIACSGAVSALILPLSSAKALMRSLSTRHATFAAFTAGALAGDVARGD
FT                   FERRFADFVDDIVGFEANRAFASFEDPHIRARSRRLARLNSEFMNACTRLHALHQLVKR
FT                   LRANQSDAVLDALAPHIDALALRFAALRDERQRGIAPATGALLELRRFHGALPKAARAS
FT                   RRTLEDHAAGGLLDFDTAIELLYRFIGEYLGYVDTYASLDQDDHAFERSVTHYAVKTNA
FT                   FFVGFAFLRTVVAVGAMSAFWIASEWPSGSLAVIATAIACALSSTSPRAPKFVAQMGVG
FT                   AAFATAVGYLFLCYVYPNIDGFPLLCAALAPVLGLGAFLAMRPGLSGYGIGFAVFFCLL
FT                   AGPDNTIAYTPEVLINNGLAVVVAMLACSLVFAVVFPTHMPWLTGRIAHDLCRQVTLAC
FT                   EGAPDGLAQRFQSSTHDLMAQLRTLLVRRTRQHRDALRWMLSTLEVGHAVIDLRDELHA
FT                   FCASKPPQTLRWTGSIDAVLNELPRFFDDPTPSRHARTLKSVNLAIRAAQHTLQAWYAV
FT                   PDARRSMQRIVGCLHFMRSALLDKDAPFNRHRH"
     MKPQPAIERP SIEPARWSAW LDPLGNAARD WAATDGLIWL HLAKTVLAAL LAMGIAMRLE        60
     MSQPRTAMTT VFVLMQPLSG MVFAKSFYRV LGTAAGLVGA LALGGLFAQQ PELYMAGITL       120
     WIGGCIALAV RNRHFRWYGF VLAGYTAALI GLPAVMTPQT LFQSALTRAA EVALGIACSG       180
     AVSALILPLS SAKALMRSLS TRHATFAAFT AGALAGDVAR GDFERRFADF VDDIVGFEAN       240
     RAFASFEDPH IRARSRRLAR LNSEFMNACT RLHALHQLVK RLRANQSDAV LDALAPHIDA       300
     LALRFAALRD ERQRGIAPAT GALLELRRFH GALPKAARAS RRTLEDHAAG GLLDFDTAIE       360
     LLYRFIGEYL GYVDTYASLD QDDHAFERSV THYAVKTNAF FVGFAFLRTV VAVGAMSAFW       420
     IASEWPSGSL AVIATAIACA LSSTSPRAPK FVAQMGVGAA FATAVGYLFL CYVYPNIDGF       480
     PLLCAALAPV LGLGAFLAMR PGLSGYGIGF AVFFCLLAGP DNTIAYTPEV LINNGLAVVV       540
     AMLACSLVFA VVFPTHMPWL TGRIAHDLCR QVTLACEGAP DGLAQRFQSS THDLMAQLRT       600
     LLVRRTRQHR DALRWMLSTL EVGHAVIDLR DELHAFCASK PPQTLRWTGS IDAVLNELPR       660
     FFDDPTPSRH ARTLKSVNLA IRAAQHTLQA WYAVPDARRS MQRIVGCLHF MRSALLDKDA       720
     PFNRHRH                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page