(data stored in ACNUC1104 zone)

EMBL: CP000959.PE120

CP000959.PE120       Location/Qualifiers
FT   CDS             138505..139560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3306"
FT                   /product="Domain of unknown function DUF1839"
FT                   /note="PFAM: Domain of unknown function DUF1839; KEGG:
FT                   bur:Bcep18194_B1807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92461"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:B1K996"
FT                   /protein_id="ACA92461.1"
FT                   /translation="MRFVSRDGEDASFESVRHRARHYRPHPLHSQEMVWKQTNCYVDMW
FT                   LEVLRWWGLNPYAALPFTIALDFEGDQFTFFKFPHDELERLYGIVVQEHSIYEPLDQHI
FT                   ETQVARGHLMIVEVDAWFLPDTRGSSYRTQHTKTTIGIDAIDRAKHQIGYFHNSGYYVA
FT                   EDFDYNGLVGGSSPMTLPPYVECAKRRFAPLDERALCEASLAALQRHLRRLPVVDPIAA
FT                   FRRQLQADAPILAEAPLEHFHAYSFNSVRQLGANFELFGHYARWLQASGCTGPFAEIRA
FT                   ACDRIASEAMVLEFRLARACARGKEERGDSTLEAIETAYGDLVACARQIGAPLRHVTPV
FT                   RYDTEPVSAMR"
     MRFVSRDGED ASFESVRHRA RHYRPHPLHS QEMVWKQTNC YVDMWLEVLR WWGLNPYAAL        60
     PFTIALDFEG DQFTFFKFPH DELERLYGIV VQEHSIYEPL DQHIETQVAR GHLMIVEVDA       120
     WFLPDTRGSS YRTQHTKTTI GIDAIDRAKH QIGYFHNSGY YVAEDFDYNG LVGGSSPMTL       180
     PPYVECAKRR FAPLDERALC EASLAALQRH LRRLPVVDPI AAFRRQLQAD APILAEAPLE       240
     HFHAYSFNSV RQLGANFELF GHYARWLQAS GCTGPFAEIR AACDRIASEA MVLEFRLARA       300
     CARGKEERGD STLEAIETAY GDLVACARQI GAPLRHVTPV RYDTEPVSAM R                351
//

If you have problems or comments...

PBIL Back to PBIL home page