(data stored in ACNUC1104 zone)

EMBL: CP000959.PE127

CP000959.PE127       Location/Qualifiers
FT   CDS             complement(149898..152105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3313"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   bpd:BURPS668_A2840 capsular exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92468"
FT                   /db_xref="GOA:B1K9A3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9A3"
FT                   /protein_id="ACA92468.1"
FT                   /translation="MPDESGMAQLWHAIRRHRRVFLATIGATFATGVLYALLATPQYRA
FT                   EALLRVQTKPGSSISSLSDVSGTITASPSASDESEMLISRAVIDNAISTTGADLDIRNA
FT                   SRFPLIGGLVASRFDVDDTLASAPLGLTGYAWGGERIDIGEFLLPKNALGERFRIVAED
FT                   ANNWTLYDDDNNVLARGKVGEAVPFRLPGEATAGRLRIDVLRARPGIAFTVRKQPEPLV
FT                   YENVSKHLKTVVPNRDSTLESPSMIRLSYQADNARDAKKMVDAIVQQYLQRDLAFRTDR
FT                   ARRNLDALRQRLPALKHDLQQAEDDLNRYRTQNGAIDVDQQGAALISRLNTLAEHQTEL
FT                   QISLDDVRQRFLPKSLQYQTVQAQLEQVKREIRDTSAMAARLPTTQREFVRLSRQVTIA
FT                   TQLYTGVLTNAQQLEIAISSAAPGVTAVDTAVAPFRPVWPKRGIIVLGALFAGVFLALT
FT                   GVHLLSLHRRELYSPAALTRLTGRPCLAIVTSSPASAAVPGGPRSTALPVAATHPDDAG
FT                   IDSVRALRASLKVALAERRPGSGGKVLLFTGPTAGVGCSFVSSNLAYLLTGANASVLLI
FT                   NADLRGSSVAGGPGLAQVLDGSVLPDVVTLRVAGSRLSIMPAGSPDKTSPGELLEGAEF
FT                   ARLLASVRERYDFIVIDGPPLLTSNDALGIVGAGCDAHVLVSRGGLTRASDVEEALSRL
FT                   TSIGADITGHVFNTYTGTNKIIVERVTTRGFPVRTAARQRA"
     MPDESGMAQL WHAIRRHRRV FLATIGATFA TGVLYALLAT PQYRAEALLR VQTKPGSSIS        60
     SLSDVSGTIT ASPSASDESE MLISRAVIDN AISTTGADLD IRNASRFPLI GGLVASRFDV       120
     DDTLASAPLG LTGYAWGGER IDIGEFLLPK NALGERFRIV AEDANNWTLY DDDNNVLARG       180
     KVGEAVPFRL PGEATAGRLR IDVLRARPGI AFTVRKQPEP LVYENVSKHL KTVVPNRDST       240
     LESPSMIRLS YQADNARDAK KMVDAIVQQY LQRDLAFRTD RARRNLDALR QRLPALKHDL       300
     QQAEDDLNRY RTQNGAIDVD QQGAALISRL NTLAEHQTEL QISLDDVRQR FLPKSLQYQT       360
     VQAQLEQVKR EIRDTSAMAA RLPTTQREFV RLSRQVTIAT QLYTGVLTNA QQLEIAISSA       420
     APGVTAVDTA VAPFRPVWPK RGIIVLGALF AGVFLALTGV HLLSLHRREL YSPAALTRLT       480
     GRPCLAIVTS SPASAAVPGG PRSTALPVAA THPDDAGIDS VRALRASLKV ALAERRPGSG       540
     GKVLLFTGPT AGVGCSFVSS NLAYLLTGAN ASVLLINADL RGSSVAGGPG LAQVLDGSVL       600
     PDVVTLRVAG SRLSIMPAGS PDKTSPGELL EGAEFARLLA SVRERYDFIV IDGPPLLTSN       660
     DALGIVGAGC DAHVLVSRGG LTRASDVEEA LSRLTSIGAD ITGHVFNTYT GTNKIIVERV       720
     TTRGFPVRTA ARQRA                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page