(data stored in ACNUC1104 zone)

EMBL: CP000959.PE130

CP000959.PE130       Location/Qualifiers
FT   CDS             complement(154975..156228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3316"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bvi:Bcep1808_4768 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92471"
FT                   /db_xref="GOA:B1K9A6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9A6"
FT                   /protein_id="ACA92471.1"
FT                   /translation="MTAVRKNFALLFALQISTYVVPLVTLPLLTRVLGPQEYGRLSFVL
FT                   AVTTYFINLANYSFDLTATPRVALANDRMERSRIFWTTVCAQWAITVAGFGLLVALTML
FT                   IPHFAAERRALLIGFGMAIGAALTPGWYFQGIQKLSVYSVTVVVYRVLSVAAIFLWVRT
FT                   EDDLLHAVAINTAVPLLCGITLLAYLFFHREVERVQVRLSDVVEALKGGFQVFLASTSI
FT                   SFYASTNTVLLSMVSGNVAAGYFAAGDKLIRAAVGLLQPLRAATYPHVTYLMHHARDEA
FT                   FAFLRKLIVMQGALVLAMSATIYACAPLAVRILYGSSFAPTIGVLHCLALVPFMACMTD
FT                   LFGVQTMLPLGMKRAFSVILISSGALNVTLLPPLAMLFAERGAAIAVLIAETAVAVALA
FT                   YVLRRERVGVLDLSARSG"
     MTAVRKNFAL LFALQISTYV VPLVTLPLLT RVLGPQEYGR LSFVLAVTTY FINLANYSFD        60
     LTATPRVALA NDRMERSRIF WTTVCAQWAI TVAGFGLLVA LTMLIPHFAA ERRALLIGFG       120
     MAIGAALTPG WYFQGIQKLS VYSVTVVVYR VLSVAAIFLW VRTEDDLLHA VAINTAVPLL       180
     CGITLLAYLF FHREVERVQV RLSDVVEALK GGFQVFLAST SISFYASTNT VLLSMVSGNV       240
     AAGYFAAGDK LIRAAVGLLQ PLRAATYPHV TYLMHHARDE AFAFLRKLIV MQGALVLAMS       300
     ATIYACAPLA VRILYGSSFA PTIGVLHCLA LVPFMACMTD LFGVQTMLPL GMKRAFSVIL       360
     ISSGALNVTL LPPLAMLFAE RGAAIAVLIA ETAVAVALAY VLRRERVGVL DLSARSG          417
//

If you have problems or comments...

PBIL Back to PBIL home page