(data stored in ACNUC1104 zone)

EMBL: CP000959.PE133

CP000959.PE133       Location/Qualifiers
FT   CDS             complement(159933..161084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3319"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bur:Bcep18194_B1817 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92474"
FT                   /db_xref="GOA:B1K9A9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9A9"
FT                   /protein_id="ACA92474.1"
FT                   /translation="MPRLRVAMAATVCVLNACAFAPGMTYQAPAERDANARVSVAATGS
FT                   GGLDGVQNVSSEDLIEITPAFVEQQHAARSAGVDAEIRQLFGTPKAYVIGPGDVLNIVV
FT                   WDHPELNLPTAQATNGDNIGTNSVVAGYTVDAGGNVQFAQAGLVHVAGLTEAEARAAVT
FT                   RRLGEYVRKPQIALRIQAYRSKRVYLDGEVRTPGLQIVNDMPMTLPEAIDRAGGFTAGA
FT                   DRSQVTVTRGGKTVNVSLPAMIAAGINPSNILLRDGDLVRVRPTSEAKVFVLGEVSRPA
FT                   TLTLTDGRISLGEALGETGGVSQYTSDARQIYVVRRGPGNRPQVYHLDGRAPASYALAD
FT                   QFPLERRDVVFVDASSLVRWSRVVNLLIPSAAQGALTARAVTP"
     MPRLRVAMAA TVCVLNACAF APGMTYQAPA ERDANARVSV AATGSGGLDG VQNVSSEDLI        60
     EITPAFVEQQ HAARSAGVDA EIRQLFGTPK AYVIGPGDVL NIVVWDHPEL NLPTAQATNG       120
     DNIGTNSVVA GYTVDAGGNV QFAQAGLVHV AGLTEAEARA AVTRRLGEYV RKPQIALRIQ       180
     AYRSKRVYLD GEVRTPGLQI VNDMPMTLPE AIDRAGGFTA GADRSQVTVT RGGKTVNVSL       240
     PAMIAAGINP SNILLRDGDL VRVRPTSEAK VFVLGEVSRP ATLTLTDGRI SLGEALGETG       300
     GVSQYTSDAR QIYVVRRGPG NRPQVYHLDG RAPASYALAD QFPLERRDVV FVDASSLVRW       360
     SRVVNLLIPS AAQGALTARA VTP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page