(data stored in ACNUC1104 zone)

EMBL: CP000959.PE134

CP000959.PE134       Location/Qualifiers
FT   CDS             complement(161536..163926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0441 outer membrane protein,
FT                   haemagluttinin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92475"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B0"
FT                   /protein_id="ACA92475.1"
FT                   /translation="MAFQLQDRVQETTTSTGTGALSLAGAMTGFRAFSSVCANADTFYY
FT                   GLQAVTGTGVPSGNWEIGIGAYNASGNTLSRTTVLASSNGGAIVNLAAGTTQVWMDLPA
FT                   ALPANLPVSAKYFGAKGNTRIVNDGVTTSGSTSFSSASAVFTAADVGKRIDIATTNASG
FT                   VATLVVSTTIAAFVSATQITLAKAANASATGANVVYGSDDGPALTAWLNYLMTIWPVKG
FT                   DLPAGVYYSSLALPSITRPIAVFGHSARTSIIQFGAGVSGQCLTVLNAGFNNEATDLPQ
FT                   TGNVSWTSNMAVLAGCVLRDFTLQGNRACASLQHGLVLQGNVDWLDVAHVNCLYFRGGG
FT                   VLWMDTGSGSTQARANVREINLNTMKIRHCGDLSTNTPSFGIYLDDSPAATMSDSSNLF
FT                   NLNNIDIIFSYGTALAVQDRRTSNTGFPLYGIQARNIVLHDRMTTMGLSGGRMFSVIGQ
FT                   VTNCLFDINFPLSARNDYAAEIRPNPNFNVYPTDNEFTFAFPKTVKGVTIGNIGYNTIR
FT                   FRNYFGCAEAVFISTESPYNLRIDCETDSVFQQVTSALVLTGTGAVAIPGWSFGTTPNL
FT                   SIFMPVNAVNGTGDTTLATIFGITGTIARSGSVTAGTDTYTFTPSSSSTAYIPAGEYFS
FT                   KICVDASQGNGVAGRYKYIPEDRYGRAVNSAWASGRLLQMWPWQFHIENATGLVRYSYG
FT                   VPTADSAGNAMAVWSNGFVGTSSTPGVTGISKLTANYASPTMLTNLVGGIDGQSVRIIA
FT                   TNGNCTIANNANIQTTTGGNVVMVSGQVLTFTFDATLNKWCGG"
     MAFQLQDRVQ ETTTSTGTGA LSLAGAMTGF RAFSSVCANA DTFYYGLQAV TGTGVPSGNW        60
     EIGIGAYNAS GNTLSRTTVL ASSNGGAIVN LAAGTTQVWM DLPAALPANL PVSAKYFGAK       120
     GNTRIVNDGV TTSGSTSFSS ASAVFTAADV GKRIDIATTN ASGVATLVVS TTIAAFVSAT       180
     QITLAKAANA SATGANVVYG SDDGPALTAW LNYLMTIWPV KGDLPAGVYY SSLALPSITR       240
     PIAVFGHSAR TSIIQFGAGV SGQCLTVLNA GFNNEATDLP QTGNVSWTSN MAVLAGCVLR       300
     DFTLQGNRAC ASLQHGLVLQ GNVDWLDVAH VNCLYFRGGG VLWMDTGSGS TQARANVREI       360
     NLNTMKIRHC GDLSTNTPSF GIYLDDSPAA TMSDSSNLFN LNNIDIIFSY GTALAVQDRR       420
     TSNTGFPLYG IQARNIVLHD RMTTMGLSGG RMFSVIGQVT NCLFDINFPL SARNDYAAEI       480
     RPNPNFNVYP TDNEFTFAFP KTVKGVTIGN IGYNTIRFRN YFGCAEAVFI STESPYNLRI       540
     DCETDSVFQQ VTSALVLTGT GAVAIPGWSF GTTPNLSIFM PVNAVNGTGD TTLATIFGIT       600
     GTIARSGSVT AGTDTYTFTP SSSSTAYIPA GEYFSKICVD ASQGNGVAGR YKYIPEDRYG       660
     RAVNSAWASG RLLQMWPWQF HIENATGLVR YSYGVPTADS AGNAMAVWSN GFVGTSSTPG       720
     VTGISKLTAN YASPTMLTNL VGGIDGQSVR IIATNGNCTI ANNANIQTTT GGNVVMVSGQ       780
     VLTFTFDATL NKWCGG                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page