(data stored in ACNUC1104 zone)

EMBL: CP000959.PE135

CP000959.PE135       Location/Qualifiers
FT   CDS             164630..166831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3321"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bur:Bcep18194_B1822 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92476"
FT                   /db_xref="GOA:B1K9B1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B1"
FT                   /protein_id="ACA92476.1"
FT                   /translation="MRDKLWPAVVLAATLCTTAYAGDADFNAQGDATDAFASAAAQRRA
FT                   DLLVRKMTLDEKLQFIHSQYEMSKVPGGGAGYIQGVPRLGIPDLNMVDSATGSGSTSQA
FT                   STTFPATIAVAASWDRRLSYDYGKQVAIQLRAQGFGMGLAGGTNLAREPRGGRLFEYLG
FT                   EDPLLAGDLLAERTLATQRQKVIATIKHYAGNEQEHGRMGGNTQIDERTLRELYLLPFE
FT                   IAAKRGRPGSVMCSYNRLNGTYACENPHLLNDVLKNEWGFQGQVQSDWGATHSTAAAIN
FT                   AGLDEEEDVGPSVYLTPAAVKQAIANGSVSTARLDDMVRRKLAVMIRVGVMDDPAQGGG
FT                   TIDFAAGNRFAQAASEQSIVLLKNDGNQLPLVASALSRIAVIGGHADAAVLSGGGSGNT
FT                   RDPVSGSFAGCGGLTFGSSTGCSWWRNPWLKVDVPIVAAIRALAPAAQVTYAGNSDQQS
FT                   PFRAYTQQEIDQAAALAGRSDVAIVVVAQPAGEDFGDLQSLSLANPSNQDALVEAVARA
FT                   NPHTVVVVQSGNPVLMPWKDNVSAIVEAWYPGEAGGKAIANVLFGAVNPSGKLPVTFPA
FT                   RDQDSPTWGQNGAFDHDPVYAEKLDMGYRWYDARNIKPMFEFGYGLSYTHFAYSGLSVS
FT                   KQWDGSLSVAFTVRNDGRVAGAETPQVYLGVPYKDEPPKRLVGWEKIRLNPGEARRVRV
FT                   TVSPRMQSVWDTSRNGWRVVSGGTVYVGASSRDIRLQGH"
     MRDKLWPAVV LAATLCTTAY AGDADFNAQG DATDAFASAA AQRRADLLVR KMTLDEKLQF        60
     IHSQYEMSKV PGGGAGYIQG VPRLGIPDLN MVDSATGSGS TSQASTTFPA TIAVAASWDR       120
     RLSYDYGKQV AIQLRAQGFG MGLAGGTNLA REPRGGRLFE YLGEDPLLAG DLLAERTLAT       180
     QRQKVIATIK HYAGNEQEHG RMGGNTQIDE RTLRELYLLP FEIAAKRGRP GSVMCSYNRL       240
     NGTYACENPH LLNDVLKNEW GFQGQVQSDW GATHSTAAAI NAGLDEEEDV GPSVYLTPAA       300
     VKQAIANGSV STARLDDMVR RKLAVMIRVG VMDDPAQGGG TIDFAAGNRF AQAASEQSIV       360
     LLKNDGNQLP LVASALSRIA VIGGHADAAV LSGGGSGNTR DPVSGSFAGC GGLTFGSSTG       420
     CSWWRNPWLK VDVPIVAAIR ALAPAAQVTY AGNSDQQSPF RAYTQQEIDQ AAALAGRSDV       480
     AIVVVAQPAG EDFGDLQSLS LANPSNQDAL VEAVARANPH TVVVVQSGNP VLMPWKDNVS       540
     AIVEAWYPGE AGGKAIANVL FGAVNPSGKL PVTFPARDQD SPTWGQNGAF DHDPVYAEKL       600
     DMGYRWYDAR NIKPMFEFGY GLSYTHFAYS GLSVSKQWDG SLSVAFTVRN DGRVAGAETP       660
     QVYLGVPYKD EPPKRLVGWE KIRLNPGEAR RVRVTVSPRM QSVWDTSRNG WRVVSGGTVY       720
     VGASSRDIRL QGH                                                          733
//

If you have problems or comments...

PBIL Back to PBIL home page