(data stored in ACNUC1104 zone)

EMBL: CP000959.PE137

CP000959.PE137       Location/Qualifiers
FT   CDS             complement(167036..167614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92478"
FT                   /db_xref="InterPro:IPR032349"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B3"
FT                   /protein_id="ACA92478.1"
FT                   /translation="MLTAYYVHRLPADYDLDIIRNRVRERGRLWDDTPDLLFKGFLLRE
FT                   AGRHGATENGYASFYLWRNEQAFARFVTDGRYRVVTDSFGRAPIDTQVALDARKGSAST
FT                   GRFARLETIEIPADADLDAALAREIARNREAAARQGVVAAAVSLDPLRWRLTRALVTEH
FT                   EPDDGGAGTVYQVLHLARPLLDTLDAGRA"
     MLTAYYVHRL PADYDLDIIR NRVRERGRLW DDTPDLLFKG FLLREAGRHG ATENGYASFY        60
     LWRNEQAFAR FVTDGRYRVV TDSFGRAPID TQVALDARKG SASTGRFARL ETIEIPADAD       120
     LDAALAREIA RNREAAARQG VVAAAVSLDP LRWRLTRALV TEHEPDDGGA GTVYQVLHLA       180
     RPLLDTLDAG RA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page