(data stored in ACNUC1104 zone)

EMBL: CP000959.PE138

CP000959.PE138       Location/Qualifiers
FT   CDS             167745..168602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3324"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B1830
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92479"
FT                   /db_xref="GOA:B1K9B4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B4"
FT                   /protein_id="ACA92479.1"
FT                   /translation="MKTLDIEAVQAFVLTADLKSFTRAAEALDTTQSAVSLKIKRLEDG
FT                   LGRRLLERTPRQVRLSADGTAFLEPARELVAAHHGALGAFGTSQRRLVIGVSHHVVGAD
FT                   LPMLLRRMSEAEPALVLEIRVAASRDVLDAFDRGRLDAAVALQHDSRRLDGETILSESF
FT                   GWMAAADFEYHPPQPLRLATQAEPCSVRRMAVDALDEAGVAWTEVFVGGGVATIGAAVS
FT                   AGLAVAALGHRVAPAGTVDVGTRYGLPPLPARDVVLYSNLTDAHARQALRTLGAALRSS
FT                   VGVR"
     MKTLDIEAVQ AFVLTADLKS FTRAAEALDT TQSAVSLKIK RLEDGLGRRL LERTPRQVRL        60
     SADGTAFLEP ARELVAAHHG ALGAFGTSQR RLVIGVSHHV VGADLPMLLR RMSEAEPALV       120
     LEIRVAASRD VLDAFDRGRL DAAVALQHDS RRLDGETILS ESFGWMAAAD FEYHPPQPLR       180
     LATQAEPCSV RRMAVDALDE AGVAWTEVFV GGGVATIGAA VSAGLAVAAL GHRVAPAGTV       240
     DVGTRYGLPP LPARDVVLYS NLTDAHARQA LRTLGAALRS SVGVR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page