(data stored in ACNUC1104 zone)

EMBL: CP000959.PE141

CP000959.PE141       Location/Qualifiers
FT   CDS             complement(170579..171973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3327"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bur:Bcep18194_B1835
FT                   OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92482"
FT                   /db_xref="GOA:B1K9B7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B7"
FT                   /protein_id="ACA92482.1"
FT                   /translation="MGNRDTRRPRARPGTVRPLSRWLGATLFACAAAAHAAPQPDGDAP
FT                   PRWQAGADGIGFWPGGDAAGFDASAWMTDAGPARGARNEASGDERQPDTIPLTARKITL
FT                   GQRTGAAARACEAAGDAGADGIGFDDGRTGGGCDPAATHDAPAGDAAARGVVHADRMPY
FT                   ELHPVDPSRLPDLPAAQAPPLLEQLMGDDRNMVGLGWHFVGTTGRSTPVTTRTDALGLN
FT                   SFQNAGSSLSLSNTNTLAFTFTHFVSEHWAAELGAGIPPVLTLRGHGSIALPLDRIFAG
FT                   VHGRFPLIDLGNTQSNPLATTRAWLGSVVFKYYLGERDDRFRPFAGIGVSYTRFTNTNL
FT                   NPVFQRKLASLGGLLAAGADIGSLQSLLLDPALFQRIWDAGGDLLLSGRTNVSAKVKSV
FT                   WEPVFTVGASYQITRRFWLTGMVTYIPLRTRITLDINQPNRLLASNTFDISANPVLATV
FT                   LLNFRF"
     MGNRDTRRPR ARPGTVRPLS RWLGATLFAC AAAAHAAPQP DGDAPPRWQA GADGIGFWPG        60
     GDAAGFDASA WMTDAGPARG ARNEASGDER QPDTIPLTAR KITLGQRTGA AARACEAAGD       120
     AGADGIGFDD GRTGGGCDPA ATHDAPAGDA AARGVVHADR MPYELHPVDP SRLPDLPAAQ       180
     APPLLEQLMG DDRNMVGLGW HFVGTTGRST PVTTRTDALG LNSFQNAGSS LSLSNTNTLA       240
     FTFTHFVSEH WAAELGAGIP PVLTLRGHGS IALPLDRIFA GVHGRFPLID LGNTQSNPLA       300
     TTRAWLGSVV FKYYLGERDD RFRPFAGIGV SYTRFTNTNL NPVFQRKLAS LGGLLAAGAD       360
     IGSLQSLLLD PALFQRIWDA GGDLLLSGRT NVSAKVKSVW EPVFTVGASY QITRRFWLTG       420
     MVTYIPLRTR ITLDINQPNR LLASNTFDIS ANPVLATVLL NFRF                        464
//

If you have problems or comments...

PBIL Back to PBIL home page