(data stored in ACNUC1104 zone)

EMBL: CP000959.PE142

CP000959.PE142       Location/Qualifiers
FT   CDS             complement(171978..173273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3328"
FT                   /product="multidrug resistance efflux pump-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1836 multidrug resistance
FT                   efflux pump-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92483"
FT                   /db_xref="GOA:B1K9B8"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B8"
FT                   /protein_id="ACA92483.1"
FT                   /translation="MPTWNSALREQKPSRKLARGTTFGTVIHGVVDVPVSMRFFCYLSL
FT                   AMFAMFVTALVELSYANTESVSGMLTPRSGLIGVGAPPGWAVRDVYVGKDQHVKAGQRL
FT                   LAVTRDTSFVSQANNVQGMRAALDRQRVEVTQQIDAARLEYRSSVQQINQQIAAQGESR
FT                   GLIDRQIQDQKRIVDEYGERRARVKQLLDEQVVTLEQYNQVNTQYLQAGQAYQDLLLRR
FT                   AELAKNAMKLRGDLDTMQSKYDGANAELKIKQEELNAKEYNIDENVNQVLYAPADGQIV
FT                   RLDVVQGGVIDPPGTRVVEILPAKADGLIAEVYIPSSKAGFVKKGQEVKVAYASYPVEK
FT                   FGTYRGKVLSISPVAFSAKELNLPGDAAVPQTYFKTWVELADRTPSFDGRPLSLRAGMM
FT                   LKADIVLERRSLLEWLFEPLYRIRQRLFGVPA"
     MPTWNSALRE QKPSRKLARG TTFGTVIHGV VDVPVSMRFF CYLSLAMFAM FVTALVELSY        60
     ANTESVSGML TPRSGLIGVG APPGWAVRDV YVGKDQHVKA GQRLLAVTRD TSFVSQANNV       120
     QGMRAALDRQ RVEVTQQIDA ARLEYRSSVQ QINQQIAAQG ESRGLIDRQI QDQKRIVDEY       180
     GERRARVKQL LDEQVVTLEQ YNQVNTQYLQ AGQAYQDLLL RRAELAKNAM KLRGDLDTMQ       240
     SKYDGANAEL KIKQEELNAK EYNIDENVNQ VLYAPADGQI VRLDVVQGGV IDPPGTRVVE       300
     ILPAKADGLI AEVYIPSSKA GFVKKGQEVK VAYASYPVEK FGTYRGKVLS ISPVAFSAKE       360
     LNLPGDAAVP QTYFKTWVEL ADRTPSFDGR PLSLRAGMML KADIVLERRS LLEWLFEPLY       420
     RIRQRLFGVP A                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page