(data stored in ACNUC1104 zone)

EMBL: CP000959.PE143

CP000959.PE143       Location/Qualifiers
FT   CDS             complement(173286..174287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92484"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B9"
FT                   /protein_id="ACA92484.1"
FT                   /translation="MLGRLFLLNPFSYAFLLRRAVRAIALRTSPARGLRLMRWCSGACL
FT                   RCFPCIRESIERAVAYMLSAHLNDDPRRVREVSAAIVRELFEAEFAGLKLRTHSLASMK
FT                   TMIDGMACEGDDQLRAALARGGPLMLAGLHFGNLMLFVTKLRFMIPDDRKLMVILHRDA
FT                   PGAFFDDALRLVAEYGAGEVEFIDIEERVHLRRLITSLRREAPVFLLFSDLHGKFGKTN
FT                   RCRLGGRWVRMAGGGVKLAVEQGIPLLVAYATGVPFRDRCAVHFTELAASPLAPMLGTD
FT                   DDASPVRATHQRIVDRLEQALVRQPEQWHFWEHFTPYLMPTPLLDAAARRRS"
     MLGRLFLLNP FSYAFLLRRA VRAIALRTSP ARGLRLMRWC SGACLRCFPC IRESIERAVA        60
     YMLSAHLNDD PRRVREVSAA IVRELFEAEF AGLKLRTHSL ASMKTMIDGM ACEGDDQLRA       120
     ALARGGPLML AGLHFGNLML FVTKLRFMIP DDRKLMVILH RDAPGAFFDD ALRLVAEYGA       180
     GEVEFIDIEE RVHLRRLITS LRREAPVFLL FSDLHGKFGK TNRCRLGGRW VRMAGGGVKL       240
     AVEQGIPLLV AYATGVPFRD RCAVHFTELA ASPLAPMLGT DDDASPVRAT HQRIVDRLEQ       300
     ALVRQPEQWH FWEHFTPYLM PTPLLDAAAR RRS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page