(data stored in ACNUC1104 zone)

EMBL: CP000959.PE15

CP000959.PE15        Location/Qualifiers
FT   CDS             complement(16773..18179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3200"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1685 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92356"
FT                   /db_xref="GOA:B1K876"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1K876"
FT                   /protein_id="ACA92356.1"
FT                   /translation="MAMMSESTGSLQAAPATEDAPRALSQTLSVRDAVMITVSGVTPAS
FT                   SIFVIAPFAIQQAGSGAVLSFLLGGVLALAFALCYAELSAAHRSAGGEYVMAKRVFGTL
FT                   PGYLTFITVLSVSVFIPAVLASGAAPYLNNALGTHFGNQSVALTIVLLSYLLGMLNIKT
FT                   NAWITGAFLVVEIGVLTLIAGLGFGSPHRGADVLIAPVVASGNALVPATLAAIVPAIGT
FT                   AIFCYNGFGSAAYLAEDLRGGNRNVAKAVIYSLLVILVVELVPLTAIVLGAPSLTELTK
FT                   SADPIGYVVRSLSNPAVSRVVSGGIFLSVFNAIIAIVITMGRLLYSSGRHALWSRTCNR
FT                   AFSTIHPRLESPWLATLALAIPSAGLVFVSSLDELTAFTVDLLLLIYLVVGLAALASRF
FT                   VRRDVEHHYRMPLWPVTPLVAVAGAAYTLYTTLATATKPTDLIIIAGLLVAALVMYVAW
FT                   ARHSEAFRAL"
     MAMMSESTGS LQAAPATEDA PRALSQTLSV RDAVMITVSG VTPASSIFVI APFAIQQAGS        60
     GAVLSFLLGG VLALAFALCY AELSAAHRSA GGEYVMAKRV FGTLPGYLTF ITVLSVSVFI       120
     PAVLASGAAP YLNNALGTHF GNQSVALTIV LLSYLLGMLN IKTNAWITGA FLVVEIGVLT       180
     LIAGLGFGSP HRGADVLIAP VVASGNALVP ATLAAIVPAI GTAIFCYNGF GSAAYLAEDL       240
     RGGNRNVAKA VIYSLLVILV VELVPLTAIV LGAPSLTELT KSADPIGYVV RSLSNPAVSR       300
     VVSGGIFLSV FNAIIAIVIT MGRLLYSSGR HALWSRTCNR AFSTIHPRLE SPWLATLALA       360
     IPSAGLVFVS SLDELTAFTV DLLLLIYLVV GLAALASRFV RRDVEHHYRM PLWPVTPLVA       420
     VAGAAYTLYT TLATATKPTD LIIIAGLLVA ALVMYVAWAR HSEAFRAL                    468
//

If you have problems or comments...

PBIL Back to PBIL home page