(data stored in ACNUC1104 zone)

EMBL: CP000959.PE153

CP000959.PE153       Location/Qualifiers
FT   CDS             188273..189610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3339"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1853 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92494"
FT                   /db_xref="GOA:B1K9C9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9C9"
FT                   /protein_id="ACA92494.1"
FT                   /translation="MDRANFRVSPTQNKTFRRLPLMPSHADSPAAHHAGSLTIFQGAAL
FT                   YIGAVLGTGVIALPALAADVAGPSSLLAWAALVVLSGPLAATFAALGARYPDAGGVSTY
FT                   ARRAFGPKAAAIVGWCFYFAVPAGAPAAAMFGGAYVAAVTGGGHTTVIVTAAALIATVS
FT                   AANAFGVTVSGRMQLVLSALLVALLLAAVLASAPHARAANLHPFAPHGWLAVGQAAALL
FT                   VWSFAGWEAITHLAAEFRRPAHDMPRSAGIAVVVVGFLYLSVAAASVTVLGPSAGASGA
FT                   PLAELIAGGIGGHAQVLAAAAALLLTLGTMNAYFAGAAKLGAALGRDGALPAWLAQGSQ
FT                   VGGVPRRSLGVIAVLAAVALAATALSDVGPKPLVLVTSGCFVMVYGLGAAAALKLLPRG
FT                   GIAYRCAWISLIAVAGLFVTTGWYFLCPLLLAGGALLYLQITGPRR"
     MDRANFRVSP TQNKTFRRLP LMPSHADSPA AHHAGSLTIF QGAALYIGAV LGTGVIALPA        60
     LAADVAGPSS LLAWAALVVL SGPLAATFAA LGARYPDAGG VSTYARRAFG PKAAAIVGWC       120
     FYFAVPAGAP AAAMFGGAYV AAVTGGGHTT VIVTAAALIA TVSAANAFGV TVSGRMQLVL       180
     SALLVALLLA AVLASAPHAR AANLHPFAPH GWLAVGQAAA LLVWSFAGWE AITHLAAEFR       240
     RPAHDMPRSA GIAVVVVGFL YLSVAAASVT VLGPSAGASG APLAELIAGG IGGHAQVLAA       300
     AAALLLTLGT MNAYFAGAAK LGAALGRDGA LPAWLAQGSQ VGGVPRRSLG VIAVLAAVAL       360
     AATALSDVGP KPLVLVTSGC FVMVYGLGAA AALKLLPRGG IAYRCAWISL IAVAGLFVTT       420
     GWYFLCPLLL AGGALLYLQI TGPRR                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page