(data stored in ACNUC1104 zone)

EMBL: CP000959.PE154

CP000959.PE154       Location/Qualifiers
FT   CDS             complement(189710..190006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92495"
FT                   /db_xref="GOA:B1K9D0"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D0"
FT                   /protein_id="ACA92495.1"
FT                   /translation="MTTTNNPHIGSDFDAFLEADGNLEAATATAIKRVIAWQIGQEMKA
FT                   QHITKTAMAARMKTSRAALNRLLDETDTSLTLATLASAAAALGKRLSFELVPA"
     MTTTNNPHIG SDFDAFLEAD GNLEAATATA IKRVIAWQIG QEMKAQHITK TAMAARMKTS        60
     RAALNRLLDE TDTSLTLATL ASAAAALGKR LSFELVPA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page