(data stored in ACNUC1104 zone)

EMBL: CP000959.PE157

CP000959.PE157       Location/Qualifiers
FT   CDS             complement(191620..192357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3343"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bam:Bamb_3581 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92498"
FT                   /db_xref="GOA:B1K9D3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D3"
FT                   /protein_id="ACA92498.1"
FT                   /translation="MTETAQLIETLKRQLKAQGMTYRDVARALDVSETSVKRLFASGRF
FT                   TLERVAEIAQLLGYTLAELVQEASASAPRLRVLTEQQEALLVSDEKLLLVAVCAINYWT
FT                   VQDIVAAYRLTQAECVKYLLMLDRMNVIALLPGDRIRVRVARDFDWLPGGPIRRYFHAH
FT                   VLDDFLGSRFDGPGETMTFLQGMLTDAAAAELEQELRRLASKAAALHAESSSAPLGQKH
FT                   GTALLIAKRIWEPTGFHALRRHG"
     MTETAQLIET LKRQLKAQGM TYRDVARALD VSETSVKRLF ASGRFTLERV AEIAQLLGYT        60
     LAELVQEASA SAPRLRVLTE QQEALLVSDE KLLLVAVCAI NYWTVQDIVA AYRLTQAECV       120
     KYLLMLDRMN VIALLPGDRI RVRVARDFDW LPGGPIRRYF HAHVLDDFLG SRFDGPGETM       180
     TFLQGMLTDA AAAELEQELR RLASKAAALH AESSSAPLGQ KHGTALLIAK RIWEPTGFHA       240
     LRRHG                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page