(data stored in ACNUC1104 zone)

EMBL: CP000959.PE158

CP000959.PE158       Location/Qualifiers
FT   CDS             192478..193053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92499"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D4"
FT                   /protein_id="ACA92499.1"
FT                   /translation="MTTRIDTAACEPHPTAPRDARDTDRTMPLATVRTLAAGAHVGDLV
FT                   FIRVPAGAPDATAGATGSAGTWANRFGIVVDTSGDEPLIAEPTVFAWTKLTPLSRFVAR
FT                   TDGGRIALARRVAAASADAQRRIHALAEQRIDALLGSRFNPQVRRGFCAQYVTDVLGAG
FT                   HAATPSALLRGGTLALEFDGIVFDPRHP"
     MTTRIDTAAC EPHPTAPRDA RDTDRTMPLA TVRTLAAGAH VGDLVFIRVP AGAPDATAGA        60
     TGSAGTWANR FGIVVDTSGD EPLIAEPTVF AWTKLTPLSR FVARTDGGRI ALARRVAAAS       120
     ADAQRRIHAL AEQRIDALLG SRFNPQVRRG FCAQYVTDVL GAGHAATPSA LLRGGTLALE       180
     FDGIVFDPRH P                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page