(data stored in ACNUC1104 zone)

EMBL: CP000959.PE160

CP000959.PE160       Location/Qualifiers
FT   CDS             194040..194633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3346"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="KEGG: bur:Bcep18194_B1860 protocatechuate
FT                   3,4-dioxygenase; TIGRFAM: protocatechuate 3,4-dioxygenase,
FT                   alpha subunit; PFAM: intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92501"
FT                   /db_xref="GOA:B1K9D6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D6"
FT                   /protein_id="ACA92501.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYDYDLKSLFTPTIAAAHAEGE
FT                   HVLLVGQVFDGDGNVVGDAVLEFTQVDGAGRYPASRDDIAKSGFTGFARVGTGTDPQQR
FT                   FVVETVKPGRVAADEAPHINVTVMMRGILTHAFTRVYFDDEAAANAIDPALNAVPAERR
FT                   ATLVAKRDAQPGRPIVYRFDIRMQGPEETVFFDV"
     MTTLKQTPSQ TVGPYFAYGL CPQQYDYDLK SLFTPTIAAA HAEGEHVLLV GQVFDGDGNV        60
     VGDAVLEFTQ VDGAGRYPAS RDDIAKSGFT GFARVGTGTD PQQRFVVETV KPGRVAADEA       120
     PHINVTVMMR GILTHAFTRV YFDDEAAANA IDPALNAVPA ERRATLVAKR DAQPGRPIVY       180
     RFDIRMQGPE ETVFFDV                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page