(data stored in ACNUC1104 zone)

EMBL: CP000959.PE161

CP000959.PE161       Location/Qualifiers
FT   CDS             complement(195065..195916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3347"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B1861 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92502"
FT                   /db_xref="GOA:B1K9D7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D7"
FT                   /protein_id="ACA92502.1"
FT                   /translation="MERIVDRSKATRLRYRVIDDGIRAVRNTLLDPYEHIPRSVVVLAN
FT                   DFAAGTTFPDHAHVRGQFAFASRGTISVSTPHGRWLVPPQRACWVPAGVRHEMTMTGPV
FT                   TMLNAFVSVDAAEAAGLPAQCGVYGVSPLLRQLLDDAIDLPAMYDVDGRAGKLMDLLVA
FT                   EIATMPRLSLHAPLPADARLAKVCRHLFAAPSIDADLDRVAADAGVSRRTFTRQFRAQT
FT                   GVSFAAWRQQVCMLAAIARLTDGQPVTRVALDLGYASASAFTSAFRRILGDTPSRYLEI
FT                   RR"
     MERIVDRSKA TRLRYRVIDD GIRAVRNTLL DPYEHIPRSV VVLANDFAAG TTFPDHAHVR        60
     GQFAFASRGT ISVSTPHGRW LVPPQRACWV PAGVRHEMTM TGPVTMLNAF VSVDAAEAAG       120
     LPAQCGVYGV SPLLRQLLDD AIDLPAMYDV DGRAGKLMDL LVAEIATMPR LSLHAPLPAD       180
     ARLAKVCRHL FAAPSIDADL DRVAADAGVS RRTFTRQFRA QTGVSFAAWR QQVCMLAAIA       240
     RLTDGQPVTR VALDLGYASA SAFTSAFRRI LGDTPSRYLE IRR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page