(data stored in ACNUC1104 zone)

EMBL: CP000959.PE165

CP000959.PE165       Location/Qualifiers
FT   CDS             complement(198708..199601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3351"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1865 ABC
FT                   dipeptide/oligopeptide/nickel family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92506"
FT                   /db_xref="GOA:B1K9E1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9E1"
FT                   /protein_id="ACA92506.1"
FT                   /translation="MNATVQPAAPAASTAIRTPWREFWRKFRKQTVALVAGGFVLALVV
FT                   LAFVGPHIVPFDPENYFDYDALNAGPSAVHWFGVDSLGRDIFSRIVAGTRISLAAGFFS
FT                   VALGAVIGTFFGLLAGYYEGWWDRITMRIADVLFAFPGILLAIGVVAILGNGMVNVICA
FT                   VAIFSIPAFARLVRGNTLMLKHMTYVEAARSIGASDWTIIMRHILPGTVSSVVVYFTMR
FT                   IGTSIITAASLSFLGLGAQPPTPEWGAMLNEARADMVTAPHIAVFPSLAIFLTVLAFNL
FT                   LGDGLRDALDPKLERR"
     MNATVQPAAP AASTAIRTPW REFWRKFRKQ TVALVAGGFV LALVVLAFVG PHIVPFDPEN        60
     YFDYDALNAG PSAVHWFGVD SLGRDIFSRI VAGTRISLAA GFFSVALGAV IGTFFGLLAG       120
     YYEGWWDRIT MRIADVLFAF PGILLAIGVV AILGNGMVNV ICAVAIFSIP AFARLVRGNT       180
     LMLKHMTYVE AARSIGASDW TIIMRHILPG TVSSVVVYFT MRIGTSIITA ASLSFLGLGA       240
     QPPTPEWGAM LNEARADMVT APHIAVFPSL AIFLTVLAFN LLGDGLRDAL DPKLERR          297
//

If you have problems or comments...

PBIL Back to PBIL home page