(data stored in ACNUC1104 zone)

EMBL: CP000959.PE167

CP000959.PE167       Location/Qualifiers
FT   CDS             complement(200597..202159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3353"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bam:Bamb_3571 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92508"
FT                   /db_xref="GOA:B1K9E3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9E3"
FT                   /protein_id="ACA92508.1"
FT                   /translation="MNKPYSFPMFRPRALFAAGAGALALSVAVPAFAQQNVVVAVYSTF
FT                   TTMDPYDANDTVSQAVVKSFYEGLFGFDRNMKLVNVLATSYTASPDAKVYTVKLRQGVK
FT                   FHDGTDFNAAAVKANFDRVTDPANKLKRYGLFRVIEKTEVVDPNTVRFTLREPFSAFIN
FT                   TLAHPSAVMISPAALKKWGRDVSLHPVGTGPFEFVEWKQTDDMKVKKFAGYWKKGYPKV
FT                   DAIDWKPVVDNNTRAALIKTGEADFAFTIPFEQATDLKSNPKVDLIEAPSIIQRYISLN
FT                   TRQKPFDNPKVREALNYAVNKDALAKVVFAGYATPQTGVAPTGVEYATKLGPWPYDPAK
FT                   ARALLKEAGYPNGFESTLWSAYNHTTAQKVIQFVQQQLAQVGVKVQVQALEAGERVARV
FT                   ESAQDAAKAPVRMYYSGWSASTGEANWALSPLLASESAPPKLYNTAYYKNGLVDDDLAQ
FT                   ALSTTDRAKKASLYADAQKQIWADAPWIFLVQEKIVYARSKRLQGMYVMPDGSFNFDEI
FT                   SLK"
     MNKPYSFPMF RPRALFAAGA GALALSVAVP AFAQQNVVVA VYSTFTTMDP YDANDTVSQA        60
     VVKSFYEGLF GFDRNMKLVN VLATSYTASP DAKVYTVKLR QGVKFHDGTD FNAAAVKANF       120
     DRVTDPANKL KRYGLFRVIE KTEVVDPNTV RFTLREPFSA FINTLAHPSA VMISPAALKK       180
     WGRDVSLHPV GTGPFEFVEW KQTDDMKVKK FAGYWKKGYP KVDAIDWKPV VDNNTRAALI       240
     KTGEADFAFT IPFEQATDLK SNPKVDLIEA PSIIQRYISL NTRQKPFDNP KVREALNYAV       300
     NKDALAKVVF AGYATPQTGV APTGVEYATK LGPWPYDPAK ARALLKEAGY PNGFESTLWS       360
     AYNHTTAQKV IQFVQQQLAQ VGVKVQVQAL EAGERVARVE SAQDAAKAPV RMYYSGWSAS       420
     TGEANWALSP LLASESAPPK LYNTAYYKNG LVDDDLAQAL STTDRAKKAS LYADAQKQIW       480
     ADAPWIFLVQ EKIVYARSKR LQGMYVMPDG SFNFDEISLK                             520
//

If you have problems or comments...

PBIL Back to PBIL home page