(data stored in ACNUC1104 zone)

EMBL: CP000959.PE168

CP000959.PE168       Location/Qualifiers
FT   CDS             complement(202289..204193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3354"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_B1868 ABC
FT                   dipeptide/oligopeptide/nickel family transporter, ATPase
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92509"
FT                   /db_xref="GOA:B1K9E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9E4"
FT                   /protein_id="ACA92509.1"
FT                   /translation="MTSSRNPSPLALPEQRVVAVDDLSVTFRREGATFDAVRNVSFHVD
FT                   RGETLAIVGESGSGKSVTSLALMRLVEHGGGEITSGRIAFRRRGGALVDLARAGAATMR
FT                   GIRGADIAMIFQEPMTSLNPVFTVGDQISEAIALHQSKGAAEARAEALRLLDLVRIPEA
FT                   RRVFARYPHQLSGGMRQRVMIAMALSCRPALLIADEPTTALDVTIQAQILQLVRGLQDE
FT                   MNMGVIFITHDMGVVAEVADRVLVMYRGEKVEEGESDRIFATPAHRYTRALLAAVPRLG
FT                   SMQGTDAPEKFPLLKVDGTRATAAAPTTTSAANNAQPPVDHAAPPILRVRDLVTRFPVK
FT                   SGVFGRVSQYVHAVERVSFELRAGETLALVGESGCGKSTTGRSLLRLVESQSGSIEFDG
FT                   RDISALKGSDLQALRRNIQFIFQDPFASLNPRLTVGFSIMEPLLVHGVASGSEAQARVD
FT                   WLLDKVGLPPEAARRYPHEFSGGQRQRIAIARALALNPKVVIADESVSALDVSVQAQIV
FT                   NLMLDLQRELGVAYLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFEAPQHPYTKK
FT                   LMSAVPVADPARRHAPRQLAADEIPSPIRAVGDEPVVAPLVAVGPDHYVATHRVGGAY"
     MTSSRNPSPL ALPEQRVVAV DDLSVTFRRE GATFDAVRNV SFHVDRGETL AIVGESGSGK        60
     SVTSLALMRL VEHGGGEITS GRIAFRRRGG ALVDLARAGA ATMRGIRGAD IAMIFQEPMT       120
     SLNPVFTVGD QISEAIALHQ SKGAAEARAE ALRLLDLVRI PEARRVFARY PHQLSGGMRQ       180
     RVMIAMALSC RPALLIADEP TTALDVTIQA QILQLVRGLQ DEMNMGVIFI THDMGVVAEV       240
     ADRVLVMYRG EKVEEGESDR IFATPAHRYT RALLAAVPRL GSMQGTDAPE KFPLLKVDGT       300
     RATAAAPTTT SAANNAQPPV DHAAPPILRV RDLVTRFPVK SGVFGRVSQY VHAVERVSFE       360
     LRAGETLALV GESGCGKSTT GRSLLRLVES QSGSIEFDGR DISALKGSDL QALRRNIQFI       420
     FQDPFASLNP RLTVGFSIME PLLVHGVASG SEAQARVDWL LDKVGLPPEA ARRYPHEFSG       480
     GQRQRIAIAR ALALNPKVVI ADESVSALDV SVQAQIVNLM LDLQRELGVA YLFISHDMAV       540
     VERISHRVAV MYLGQIVEIG PRRAVFEAPQ HPYTKKLMSA VPVADPARRH APRQLAADEI       600
     PSPIRAVGDE PVVAPLVAVG PDHYVATHRV GGAY                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page