(data stored in ACNUC1104 zone)

EMBL: CP000959.PE175

CP000959.PE175       Location/Qualifiers
FT   CDS             213983..214294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92516"
FT                   /db_xref="GOA:B1K9F1"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F1"
FT                   /protein_id="ACA92516.1"
FT                   /translation="MSGLLQSRAADIIALGTLAVLYLGGAGIALWRIRAAALPGKIYWI
FT                   VCAALLAGGAVAMAGNLAPVPNSGDMPPGFALGAEAVLLGLVLAAGGCAWLMLRARKR"
     MSGLLQSRAA DIIALGTLAV LYLGGAGIAL WRIRAAALPG KIYWIVCAAL LAGGAVAMAG        60
     NLAPVPNSGD MPPGFALGAE AVLLGLVLAA GGCAWLMLRA RKR                         103
//

If you have problems or comments...

PBIL Back to PBIL home page