(data stored in ACNUC1104 zone)

EMBL: CP000959.PE179

CP000959.PE179       Location/Qualifiers
FT   CDS             218319..218597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92520"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F5"
FT                   /protein_id="ACA92520.1"
FT                   /translation="MEHLVRIVNETDRQVLAWLRAQVGDARVERAARQLGHTRKPFPSA
FT                   VCRYLGMSAPATLRPAAARPRAARDFSVGDRYLSLIRQHLATHSVSR"
     MEHLVRIVNE TDRQVLAWLR AQVGDARVER AARQLGHTRK PFPSAVCRYL GMSAPATLRP        60
     AAARPRAARD FSVGDRYLSL IRQHLATHSV SR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page