(data stored in ACNUC1104 zone)

EMBL: CP000959.PE180

CP000959.PE180       Location/Qualifiers
FT   CDS             complement(219040..219462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3367"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: bur:Bcep18194_B1882 YeeE/YedE family membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92521"
FT                   /db_xref="GOA:B1K9F6"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F6"
FT                   /protein_id="ACA92521.1"
FT                   /translation="MQAGFSFLAGLLFGIGLIVSGMANPRKVLGFLDLAGRWDPSLAFV
FT                   MAGAIGVAVLAFAWAKRRTRSWLGLPMQLPAARTITVRLVAGSAVFGIGWGIAGFCPGP
FT                   AIVSIGFGAAKGIGFVVAMLAGMALFEWIERRRNGR"
     MQAGFSFLAG LLFGIGLIVS GMANPRKVLG FLDLAGRWDP SLAFVMAGAI GVAVLAFAWA        60
     KRRTRSWLGL PMQLPAARTI TVRLVAGSAV FGIGWGIAGF CPGPAIVSIG FGAAKGIGFV       120
     VAMLAGMALF EWIERRRNGR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page