(data stored in ACNUC1104 zone)

EMBL: CP000959.PE181

CP000959.PE181       Location/Qualifiers
FT   CDS             complement(219464..219898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3368"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: bvi:Bcep1808_4707 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92522"
FT                   /db_xref="GOA:B1K9F7"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F7"
FT                   /protein_id="ACA92522.1"
FT                   /translation="MQVDTLHFTPWLSLAGGVLIGLAAAGLVAFNGRIAGISGIVGGLL
FT                   TAAGSERGWRAAFIAGLIAAPVAMRFAGSGLTPQIDASWPELLGAGLLVGVGTRYAGGC
FT                   TSGHGVCGISRGALRSVVATATFMAAGFATVFVRLHVPGG"
     MQVDTLHFTP WLSLAGGVLI GLAAAGLVAF NGRIAGISGI VGGLLTAAGS ERGWRAAFIA        60
     GLIAAPVAMR FAGSGLTPQI DASWPELLGA GLLVGVGTRY AGGCTSGHGV CGISRGALRS       120
     VVATATFMAA GFATVFVRLH VPGG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page