(data stored in ACNUC1104 zone)

EMBL: CP000959.PE182

CP000959.PE182       Location/Qualifiers
FT   CDS             complement(219888..220238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3369"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   bur:Bcep18194_B1884 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92523"
FT                   /db_xref="GOA:B1K9F8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F8"
FT                   /protein_id="ACA92523.1"
FT                   /translation="MNDDFPAGLPGPDQMRAAAESACALLKVMSNPDRLLLLCELSQGE
FT                   RCVSDLEARLDIRQPTLSQQLGVLRDNALVRTRREGKTIRYSLDSPPVVAVMGVLYEQF
FT                   CGATAEEARDAG"
     MNDDFPAGLP GPDQMRAAAE SACALLKVMS NPDRLLLLCE LSQGERCVSD LEARLDIRQP        60
     TLSQQLGVLR DNALVRTRRE GKTIRYSLDS PPVVAVMGVL YEQFCGATAE EARDAG           116
//

If you have problems or comments...

PBIL Back to PBIL home page