(data stored in ACNUC1104 zone)

EMBL: CP000959.PE184

CP000959.PE184       Location/Qualifiers
FT   CDS             complement(221779..222987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3371"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B1886 salicylate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92525"
FT                   /db_xref="GOA:B1K9G0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9G0"
FT                   /protein_id="ACA92525.1"
FT                   /translation="MDETINKGRHVLVIGGGIGGLAAALALARQGIRVKLLEQAERIGE
FT                   IGAGIQLAANAFNALDALGVGEAARSRAVLTDWLQLMDALDAREVARIDTGAAYRERFG
FT                   NPYAVIHRADIHLSIYEAVEDHPLIEFRTSTQVCGFEQDGHGVTVIDQHGERYRADAVI
FT                   GCDGVKSAIRQALIGDAHRVTGHVVYRAVVDIDDMPKDLQINAPVVWAGPHCHLVHYPL
FT                   RGGRQYNLVVTFHSREQETWGVREGSKEEVLSYFDRIHPLPKQMLDRPTSWKRWATADR
FT                   DPVERWSTGRATVLGDAAHPMTQYIAQGACQALEDAVTLGAAVAQTDGDFEAAFALYER
FT                   VRIPRTARVLYSAREMGRIYHAKGVERQVRNGLWVGRTDAQFYDALDWLHGWRAEDCLK
FT                   TVA"
     MDETINKGRH VLVIGGGIGG LAAALALARQ GIRVKLLEQA ERIGEIGAGI QLAANAFNAL        60
     DALGVGEAAR SRAVLTDWLQ LMDALDAREV ARIDTGAAYR ERFGNPYAVI HRADIHLSIY       120
     EAVEDHPLIE FRTSTQVCGF EQDGHGVTVI DQHGERYRAD AVIGCDGVKS AIRQALIGDA       180
     HRVTGHVVYR AVVDIDDMPK DLQINAPVVW AGPHCHLVHY PLRGGRQYNL VVTFHSREQE       240
     TWGVREGSKE EVLSYFDRIH PLPKQMLDRP TSWKRWATAD RDPVERWSTG RATVLGDAAH       300
     PMTQYIAQGA CQALEDAVTL GAAVAQTDGD FEAAFALYER VRIPRTARVL YSAREMGRIY       360
     HAKGVERQVR NGLWVGRTDA QFYDALDWLH GWRAEDCLKT VA                          402
//

If you have problems or comments...

PBIL Back to PBIL home page