(data stored in ACNUC1104 zone)

EMBL: CP000959.PE194

CP000959.PE194       Location/Qualifiers
FT   CDS             231883..233508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3381"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1896 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92535"
FT                   /db_xref="GOA:B1K9H0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9H0"
FT                   /protein_id="ACA92535.1"
FT                   /translation="MPGQGNAHPSVPLSRSAHPGAGHGKFKKQLSLTDLTFIGLGAIFG
FT                   SGWLFAASHVSTIAGPAGIFSWLLGGFAVLLLGIVYCELGAALPRAGGVVRYPVFSHGP
FT                   LLGYLMGFITLIAFSSLIAIEVVAARQYAAAWFPGLTVEGSSDPTTVGWLVQAALLCFF
FT                   FYLNYSSVKTFAKANNIISVFKFIVPLAVIGVLFTFFKPANLTVHGFAPFGMPGIEMAV
FT                   SAGGIIFAYLGLTPIVSVASEVRNPQRTIPIALILSILLSTLIYVLLQLAFIGSIPTAM
FT                   LAAGWHDVSKAFSLPYRDIALALGVGWLAVMVVADAMISPSGCGNIYMNATPRVVYGWA
FT                   KTGTFFKVFTRVDEASGIPRAGLWLTFGLAIFWTLPFPSWEALINIVSAALVLSYAVAP
FT                   VSVAALRRTAPDLPRPFRASAFGLTGPASFVIAALIVYWSGWSTVSWLLGLQIVMFVIY
FT                   LACRRWVPTAHLSLAEQMRSSAWLIAFYAAMIVLSYLGGFGGTGRLAHPYDTVVVAAVA
FT                   LVIYYWGANTGVRADKLQLDDDED"
     MPGQGNAHPS VPLSRSAHPG AGHGKFKKQL SLTDLTFIGL GAIFGSGWLF AASHVSTIAG        60
     PAGIFSWLLG GFAVLLLGIV YCELGAALPR AGGVVRYPVF SHGPLLGYLM GFITLIAFSS       120
     LIAIEVVAAR QYAAAWFPGL TVEGSSDPTT VGWLVQAALL CFFFYLNYSS VKTFAKANNI       180
     ISVFKFIVPL AVIGVLFTFF KPANLTVHGF APFGMPGIEM AVSAGGIIFA YLGLTPIVSV       240
     ASEVRNPQRT IPIALILSIL LSTLIYVLLQ LAFIGSIPTA MLAAGWHDVS KAFSLPYRDI       300
     ALALGVGWLA VMVVADAMIS PSGCGNIYMN ATPRVVYGWA KTGTFFKVFT RVDEASGIPR       360
     AGLWLTFGLA IFWTLPFPSW EALINIVSAA LVLSYAVAPV SVAALRRTAP DLPRPFRASA       420
     FGLTGPASFV IAALIVYWSG WSTVSWLLGL QIVMFVIYLA CRRWVPTAHL SLAEQMRSSA       480
     WLIAFYAAMI VLSYLGGFGG TGRLAHPYDT VVVAAVALVI YYWGANTGVR ADKLQLDDDE       540
     D                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page