(data stored in ACNUC1104 zone)

EMBL: CP000959.PE202

CP000959.PE202       Location/Qualifiers
FT   CDS             complement(242877..243302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3389"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: bur:Bcep18194_B1905
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92543"
FT                   /db_xref="GOA:B1K1W4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1W4"
FT                   /protein_id="ACA92543.1"
FT                   /translation="MSRLDIADVARRTGLPASTLRYYEEKGLIVPIGRHGLRRQYDEAV
FT                   LERLALIALGREAGFSLDDILAMVGAEGRPAIDRAKLDGKADELDRTIRRLGAVRDALR
FT                   HAAVCPAANHLECPSFQKLLRIAAHRHPARRAKGEGA"
     MSRLDIADVA RRTGLPASTL RYYEEKGLIV PIGRHGLRRQ YDEAVLERLA LIALGREAGF        60
     SLDDILAMVG AEGRPAIDRA KLDGKADELD RTIRRLGAVR DALRHAAVCP AANHLECPSF       120
     QKLLRIAAHR HPARRAKGEG A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page