(data stored in ACNUC1104 zone)

EMBL: CP000959.PE203

CP000959.PE203       Location/Qualifiers
FT   CDS             243437..243934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92544"
FT                   /db_xref="GOA:B1K1W5"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1W5"
FT                   /protein_id="ACA92544.1"
FT                   /translation="MSPSDILLKLLLIGAGATLLMDLWTLFRRQAFGIPSLDYALVGRW
FT                   LGHMMHGRFRHASIVAAAPVPGERALGWVAHYAIGIAFAALPVLIAGPAWIDAPTPLPA
FT                   VVAGLASVVAPFFVMQPAFGFGIAASRTPQPGVARRRSLVTHLSYGVGLYLAAYTLAAL
FT                   SR"
     MSPSDILLKL LLIGAGATLL MDLWTLFRRQ AFGIPSLDYA LVGRWLGHMM HGRFRHASIV        60
     AAAPVPGERA LGWVAHYAIG IAFAALPVLI AGPAWIDAPT PLPAVVAGLA SVVAPFFVMQ       120
     PAFGFGIAAS RTPQPGVARR RSLVTHLSYG VGLYLAAYTL AALSR                       165
//

If you have problems or comments...

PBIL Back to PBIL home page