(data stored in ACNUC1104 zone)

EMBL: CP000959.PE204

CP000959.PE204       Location/Qualifiers
FT   CDS             complement(244052..244492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3391"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_B1907 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92545"
FT                   /db_xref="GOA:B1K1W6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1W6"
FT                   /protein_id="ACA92545.1"
FT                   /translation="MDKTYENRIGYLIADVARLNGRLFDRRAKRIGLTRAQSRVLAYLT
FT                   WKGEMNQARLAEWLEITPISLTRLLDRMESYGWIERIANDDDRRAFVIRLTDKSREIFP
FT                   QMLEVGDTVADDGLRGFTPDERDMLVRLLGRVRRNLIDCGGE"
     MDKTYENRIG YLIADVARLN GRLFDRRAKR IGLTRAQSRV LAYLTWKGEM NQARLAEWLE        60
     ITPISLTRLL DRMESYGWIE RIANDDDRRA FVIRLTDKSR EIFPQMLEVG DTVADDGLRG       120
     FTPDERDMLV RLLGRVRRNL IDCGGE                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page