(data stored in ACNUC1104 zone)

EMBL: CP000959.PE212

CP000959.PE212       Location/Qualifiers
FT   CDS             253343..254539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3399"
FT                   /product="phosphonopyruvate decarboxylase"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   KEGG: bmu:Bmul_4472 phosphonopyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92553"
FT                   /db_xref="GOA:B1K1X4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017684"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1X4"
FT                   /protein_id="ACA92553.1"
FT                   /translation="MIEAAQFVEAARQRGFDWYAGVPCSYLTPFINYVLQDPTLHYVSA
FT                   ANEGDAVALIAGATLGGKRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGV
FT                   ADEPQHALMGPITPAMLDTMEIPWETFPTDPEQVGPALDRAIAHMDETGRPYALVMQKG
FT                   SVAPYELKANPAATPRAHVAAQSASRAASADAWPTRHDALQRVIAHTPVDSTVVLASTG
FT                   FCGRELYALDDRPNQLYMVGSMGCVTPLALGLALARPDLHVVAVDGDGAALMRMGVFAT
FT                   LGTYGPANLTHVLLDNGAHESTGGQATVSQHVSFAGVAAACGYASAVDGDTLDVLDATL
FT                   STQADGVQPSGAQFVRVAIRTGVPDGLPRPTVTPVEVKTRLMRHIGAAQTEAHVEGAH"
     MIEAAQFVEA ARQRGFDWYA GVPCSYLTPF INYVLQDPTL HYVSAANEGD AVALIAGATL        60
     GGKRGIAMMQ NSGLGNAVSP LTSLTWTFRL PQLLIVTWRG QPGVADEPQH ALMGPITPAM       120
     LDTMEIPWET FPTDPEQVGP ALDRAIAHMD ETGRPYALVM QKGSVAPYEL KANPAATPRA       180
     HVAAQSASRA ASADAWPTRH DALQRVIAHT PVDSTVVLAS TGFCGRELYA LDDRPNQLYM       240
     VGSMGCVTPL ALGLALARPD LHVVAVDGDG AALMRMGVFA TLGTYGPANL THVLLDNGAH       300
     ESTGGQATVS QHVSFAGVAA ACGYASAVDG DTLDVLDATL STQADGVQPS GAQFVRVAIR       360
     TGVPDGLPRP TVTPVEVKTR LMRHIGAAQT EAHVEGAH                               398
//

If you have problems or comments...

PBIL Back to PBIL home page