(data stored in ACNUC1104 zone)

EMBL: CP000959.PE213

CP000959.PE213       Location/Qualifiers
FT   CDS             254539..255603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3400"
FT                   /product="2-aminoethylphosphonate aminotransferase"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate aminotransferase;
FT                   PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bur:Bcep18194_B1916 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92554"
FT                   /db_xref="GOA:B1K1X5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1X5"
FT                   /protein_id="ACA92554.1"
FT                   /translation="MLLLNPGPVTLSERVRRSLLQPDLCHRESEFFDLQDEARARLVAA
FT                   YELDPAEWAAVLMTGSGTAAVESMIAALVPQEGKLLVIENGVYGERITQIATQYGIAHE
FT                   VLKHEWMQAPDLAQIAAKLDAGGYSYVAVIHHETTTGRLNDLGAIAEVCRARGVKMLVD
FT                   GVSSFGAEAIDFAGGDIDAVAATANKCLHGVPGAAFVIVRRSALAKAASRTYYLDLGRL
FT                   AKLQDQRNTPFTPSVHAYYALVEALREFDEAGGWRARHAHYNALADQAQAGLAARGMPL
FT                   VLPEGASSVVLRAYRLPQGVTYEALHDGLKARGFVIYAGQGGLSKELFRISTMGAIQAA
FT                   DVDRLLEGFTALTR"
     MLLLNPGPVT LSERVRRSLL QPDLCHRESE FFDLQDEARA RLVAAYELDP AEWAAVLMTG        60
     SGTAAVESMI AALVPQEGKL LVIENGVYGE RITQIATQYG IAHEVLKHEW MQAPDLAQIA       120
     AKLDAGGYSY VAVIHHETTT GRLNDLGAIA EVCRARGVKM LVDGVSSFGA EAIDFAGGDI       180
     DAVAATANKC LHGVPGAAFV IVRRSALAKA ASRTYYLDLG RLAKLQDQRN TPFTPSVHAY       240
     YALVEALREF DEAGGWRARH AHYNALADQA QAGLAARGMP LVLPEGASSV VLRAYRLPQG       300
     VTYEALHDGL KARGFVIYAG QGGLSKELFR ISTMGAIQAA DVDRLLEGFT ALTR             354
//

If you have problems or comments...

PBIL Back to PBIL home page