(data stored in ACNUC1104 zone)

EMBL: CP000959.PE214

CP000959.PE214       Location/Qualifiers
FT   CDS             256034..257179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3401"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bam:Bamb_0192 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92555"
FT                   /db_xref="GOA:B1K1X6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1X6"
FT                   /protein_id="ACA92555.1"
FT                   /translation="MKFQLKPVNAALTLACVAMAYGQAALADVVVKIGSAEPLTGNIAH
FT                   MGQDAADGAKLAAQQINKAGNLVIGGQKVVLEIESLDDQADPRIGTNVAQKLVDDGVVA
FT                   VIGHLNSGVSIPASKIYRDNGVTQITPGSTNPQYTLQGYKTAFRVIGTDAQQGPALAKY
FT                   AKNQKVRTVAIVDDATAYGQGLADQFEKTAKAEGIQVLSRDATNDKATDFKAILTKIKA
FT                   ERPDAIMYGGEDATGGPFAKQAMQLALRARILAGDGVCTTDLARLAGDAADNLVCSVAG
FT                   GDLSAMAGSAAFSKELKAVYGHDPVVYSPVAYSAVYVIVDAMKRSNSITRAGILSAMPA
FT                   TNLNTLIGNIRFDEHGDLKDSSISLYKYVKGKRTLLEVEKM"
     MKFQLKPVNA ALTLACVAMA YGQAALADVV VKIGSAEPLT GNIAHMGQDA ADGAKLAAQQ        60
     INKAGNLVIG GQKVVLEIES LDDQADPRIG TNVAQKLVDD GVVAVIGHLN SGVSIPASKI       120
     YRDNGVTQIT PGSTNPQYTL QGYKTAFRVI GTDAQQGPAL AKYAKNQKVR TVAIVDDATA       180
     YGQGLADQFE KTAKAEGIQV LSRDATNDKA TDFKAILTKI KAERPDAIMY GGEDATGGPF       240
     AKQAMQLALR ARILAGDGVC TTDLARLAGD AADNLVCSVA GGDLSAMAGS AAFSKELKAV       300
     YGHDPVVYSP VAYSAVYVIV DAMKRSNSIT RAGILSAMPA TNLNTLIGNI RFDEHGDLKD       360
     SSISLYKYVK GKRTLLEVEK M                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page