(data stored in ACNUC1104 zone)

EMBL: CP000959.PE222

CP000959.PE222       Location/Qualifiers
FT   CDS             complement(265864..266949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3410"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bur:Bcep18194_B1931
FT                   transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92563"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Y4"
FT                   /protein_id="ACA92563.1"
FT                   /translation="MVTTKGAPKTPAGSGSARQAPASAPVPAPAQAQSQGQAATNAPAA
FT                   VAPGRLLRVTHDTEYRYAARVESAQHQARLQPLATPRQQVLSFSLDIEPAPESVCTELD
FT                   AFGNARASFALNLPHDTLLVRSRSTVRVTPPAWSLGARGEPPPAIANPDAAQATAWEVV
FT                   RDRLRFRAGQPYDPASEFLFASPHVACDPELAAYAAASFTPQRPLVQAAWDLMRRVHAD
FT                   FAYTPNSTDITTSALDALRLRKGVCQDFAHVMIGALRSLGLAARYVSGYLLTQPPPGQP
FT                   RLIGADASHAWVEVYDPVWPEDGGWLQLDPTNDRAPGDDYVMLSIGRDYADVTPLRGVI
FT                   RGGGADQELKVGVTVEPLDAA"
     MVTTKGAPKT PAGSGSARQA PASAPVPAPA QAQSQGQAAT NAPAAVAPGR LLRVTHDTEY        60
     RYAARVESAQ HQARLQPLAT PRQQVLSFSL DIEPAPESVC TELDAFGNAR ASFALNLPHD       120
     TLLVRSRSTV RVTPPAWSLG ARGEPPPAIA NPDAAQATAW EVVRDRLRFR AGQPYDPASE       180
     FLFASPHVAC DPELAAYAAA SFTPQRPLVQ AAWDLMRRVH ADFAYTPNST DITTSALDAL       240
     RLRKGVCQDF AHVMIGALRS LGLAARYVSG YLLTQPPPGQ PRLIGADASH AWVEVYDPVW       300
     PEDGGWLQLD PTNDRAPGDD YVMLSIGRDY ADVTPLRGVI RGGGADQELK VGVTVEPLDA       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page