(data stored in ACNUC1104 zone)

EMBL: CP000959.PE224

CP000959.PE224       Location/Qualifiers
FT   CDS             complement(269767..273180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3412"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bur:Bcep18194_B1933
FT                   transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92565"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Y6"
FT                   /protein_id="ACA92565.1"
FT                   /translation="MSIHVALHHTTRYRYDRLVNLGPQVVRLRPAPHCRTPILAYSMTV
FT                   EPAQHFINWQQDPFSNYLARLVFPERTEHFEITIDLVAEMSVYNPFDFFLEASAEQYPF
FT                   SYDDALKTELAPYLACDPQTSAAPLFRAYLDGVDRTPAGTTNFLVALNQQLQRDIGYLV
FT                   RMEPGVQTPAQTLELASGSCRDSAWLLVQLCRHLGIAARFVSGYLIQLTPDVKSLDGPS
FT                   GTSVDFTDLHAWCEVYLPGAGWIGFDPTSGLLAGEGHIPLACTPQPTSAAPVEGLIDEC
FT                   EVSFEHEMSVTRVYESPRVTKPYTESQWDAVLALGTQVDGALAAGDVRLTQGGEPTFVS
FT                   IDDRDGAEWNTDALGPTKRGYATELVQRLRAEYGEGGFLHFGQGKWYPGEQLPRWALSI
FT                   FWRADGQPVWRDPSLFADEREPSAYTTGDAKRFIDALAARLNLTGEFIQPGYEDVWYYL
FT                   WRERRLPVNVDPFDARLDDELERARLRKVFEQQLDSVVGYVLPVKRTDDTPGLEGPRWQ
FT                   TGPWFFRDERMYLVPGDSPMGYRLPLDSLPWAARGDHPYLVERDPFAPRDALPDAAAMR
FT                   ARYAGPADAPRYLSGVHREASAQTVMQWRDDGTATRGRPGAADPHRRPERFESAAWITR
FT                   TALCVEVRNGILYLFMPPLAALEDYLELLGAIELTAQALGVKLVLEGYPPPRDARLKLL
FT                   QVTPDPGVIEVNIHPAASFDQLVDHTEFLYDAAWQSRLCSEKFMVDGRHVGTGGGNHFV
FT                   LGGATPADSPFLRRPDLLASLIAYWHNHPSLSYLFSGLFIGPTSQAPRVDEARNDQLYE
FT                   LDIAFAEIQRNKLLFGQDMPPWLVDRVLRNLLIDVTGNTHRSEFCIDKLYSPDSSTGRL
FT                   GLLELRAFEMPPHARMSIVQQLLLRALVARFWAAPYTTPLTRWGTALHDRFMLPEFLQM
FT                   DFDDVLAELRDAGFAFDPAWFAPHFEFRFPLFGQIAVNGMELSLRGALEPWHVMGEEGA
FT                   AGGTVRYVDSSVERLEVRVTGLNDNRHVVTVNGRALPLQPTGTVGEYVAGVRYKAWSPP
FT                   SALHPTIGVHAPLTFDIVDTWLQRSLGGCRYHVAHPGGRNYATFPVNAYEAESRRLARF
FT                   VEIGHTPGRMDVAAASPSREFPFTLDLRRP"
     MSIHVALHHT TRYRYDRLVN LGPQVVRLRP APHCRTPILA YSMTVEPAQH FINWQQDPFS        60
     NYLARLVFPE RTEHFEITID LVAEMSVYNP FDFFLEASAE QYPFSYDDAL KTELAPYLAC       120
     DPQTSAAPLF RAYLDGVDRT PAGTTNFLVA LNQQLQRDIG YLVRMEPGVQ TPAQTLELAS       180
     GSCRDSAWLL VQLCRHLGIA ARFVSGYLIQ LTPDVKSLDG PSGTSVDFTD LHAWCEVYLP       240
     GAGWIGFDPT SGLLAGEGHI PLACTPQPTS AAPVEGLIDE CEVSFEHEMS VTRVYESPRV       300
     TKPYTESQWD AVLALGTQVD GALAAGDVRL TQGGEPTFVS IDDRDGAEWN TDALGPTKRG       360
     YATELVQRLR AEYGEGGFLH FGQGKWYPGE QLPRWALSIF WRADGQPVWR DPSLFADERE       420
     PSAYTTGDAK RFIDALAARL NLTGEFIQPG YEDVWYYLWR ERRLPVNVDP FDARLDDELE       480
     RARLRKVFEQ QLDSVVGYVL PVKRTDDTPG LEGPRWQTGP WFFRDERMYL VPGDSPMGYR       540
     LPLDSLPWAA RGDHPYLVER DPFAPRDALP DAAAMRARYA GPADAPRYLS GVHREASAQT       600
     VMQWRDDGTA TRGRPGAADP HRRPERFESA AWITRTALCV EVRNGILYLF MPPLAALEDY       660
     LELLGAIELT AQALGVKLVL EGYPPPRDAR LKLLQVTPDP GVIEVNIHPA ASFDQLVDHT       720
     EFLYDAAWQS RLCSEKFMVD GRHVGTGGGN HFVLGGATPA DSPFLRRPDL LASLIAYWHN       780
     HPSLSYLFSG LFIGPTSQAP RVDEARNDQL YELDIAFAEI QRNKLLFGQD MPPWLVDRVL       840
     RNLLIDVTGN THRSEFCIDK LYSPDSSTGR LGLLELRAFE MPPHARMSIV QQLLLRALVA       900
     RFWAAPYTTP LTRWGTALHD RFMLPEFLQM DFDDVLAELR DAGFAFDPAW FAPHFEFRFP       960
     LFGQIAVNGM ELSLRGALEP WHVMGEEGAA GGTVRYVDSS VERLEVRVTG LNDNRHVVTV      1020
     NGRALPLQPT GTVGEYVAGV RYKAWSPPSA LHPTIGVHAP LTFDIVDTWL QRSLGGCRYH      1080
     VAHPGGRNYA TFPVNAYEAE SRRLARFVEI GHTPGRMDVA AASPSREFPF TLDLRRP         1137
//

If you have problems or comments...

PBIL Back to PBIL home page